OriGene Logo

LRRC46 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337421
Rabbit Polyclonal Anti-LRRC46 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409563 Transient overexpression lysate of leucine rich repeat containing 46 (LRRC46) 100 ug
$436.00
TP303617 Recombinant protein of human leucine rich repeat containing 46 (LRRC46), 20 µg
20 ug
$867.00

View other "LRRC46 or NM_033413" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LRRC46 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC46. Synthetic peptide located within the following region: SPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name leucine rich repeat containing 46
Database Link
Background The function of this protein remains unknown.
Synonyms FLJ23553; MGC16309
Note Immunogen Sequence Homology: Human: 100%; Rat: 77%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.