INTS10 Rabbit Polyclonal Antibody

SKU TA337360

Rabbit Polyclonal Anti-INTS10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INTS10 antibody is: synthetic peptide directed towards the N-terminal region of Human INTS10. Synthetic peptide located within the following region: NAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 82 kDa
• Gene Name: integrator complex subunit 10
• Database Link:
  NP_060612
  Q9NVR2
• Background: INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit and mediates 3-prime end processing of small nuclear RNAs U1.
• Synonyms: C8orf35; INT10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data