OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RC74 (INTS9) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337358
Rabbit Polyclonal Anti-INTS9 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413191 Transient overexpression lysate of integrator complex subunit 9 (INTS9), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP306837 Recombinant protein of human integrator complex subunit 9 (INTS9), transcript variant 1, 20 µg
20 ug
$737.00

View other "RC74 or NM_018250" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-INTS9 antibody is: synthetic peptide directed towards the C-terminal region of Human INTS9. Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 71 kDa
Gene Name integrator complex subunit 9
Database Link
Background This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and polyadenylation specificity factor complex. Alternatively spliced transcript variants have been described.
Synonyms CPSF2L; INT9; RC74
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 85%; Bovine: 85%; Horse: 79%; Mouse: 77%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products