GLB1L3 Rabbit Polyclonal Antibody

CAT#: TA337320

Rabbit Polyclonal Anti-GLB1L3 Antibody

Product Images

Host: Rabbit; Target Name: GLB1L3; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GLB1L3 antibody is: synthetic peptide directed towards the C-terminal region of Human GLB1L3. Synthetic peptide located within the following region: KHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: galactosidase beta 1 like 3
• Database Link:
  NP_001073876
  Entrez Gene 112937 Human
  UniProt ID Q8NCI6
• Background: The function of this protein remains unknown.
• Synonyms: FLJ90231
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 91%; Zebrafish: 91%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%