OriGene Logo

GLB1L3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337320
Rabbit Polyclonal Anti-GLB1L3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY421624 Transient overexpression lysate of galactosidase, beta 1-like 3 (GLB1L3) 100 ug
$665.00

View other "GLB1L3 or NM_001080407" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GLB1L3 antibody is: synthetic peptide directed towards the C-terminal region of Human GLB1L3. Synthetic peptide located within the following region: KHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name galactosidase beta 1 like 3
Database Link
Background The function of this protein remains unknown.
Synonyms FLJ90231
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 91%; Zebrafish: 91%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.