OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAX8 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337290
Rabbit Polyclonal Anti-PAX8 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY401173 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A (as WB positive control) 100 ug
$436.00
TP300651 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg
20 ug
$867.00

View other "PAX8 or NM_013953" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name paired box 8
Database Link
Background PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development
Synonyms OTTHUMP00000158659; OTTHUMP00000158660; paired box 8; paired domain gene 8
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 79%
Reference Data
Protein Categories ADC Targets, Cancer: Endocrine, Endocrine and metabolic diseases, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products