RCOR2 Rabbit Polyclonal Antibody

SKU TA337282

Rabbit Polyclonal Anti-RCOR2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCOR2 antibody: synthetic peptide directed towards the N terminal of human RCOR2. Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: REST corepressor 2
• Database Link:
  NP_775858
  Q8IZ40
• Background: RCOR2 may act as a component of a corepressor complex that represses transcription.
• Synonyms: RCOR2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors