MIER3 Rabbit Polyclonal Antibody

CAT#: TA337281

Rabbit Polyclonal Anti-DKFZP781I1119 Antibody

Product Images

WB Suggested Anti-DKFZP781I1119 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DKFZP781I1119 antibody: synthetic peptide directed towards the N terminal of human DKFZP781I1119. Synthetic peptide located within the following region: SDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: MIER family member 3
• Database Link:
  NP_689835
  Entrez Gene 166968 Human
  UniProt ID Q7Z3K6
• Background: DKFZP781I1119 is a member of mesoderm induction early response 1 family.
• Synonyms: DKFZp686L09111; DKFZp781G1119; DKFZp781I1119; FLJ35954
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors