OriGene Logo

DMTF1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337244
Rabbit Polyclonal Anti-DMTF1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412065 Transient overexpression lysate of cyclin D binding myb-like transcription factor 1 (DMTF1), transcript variant 1 100 ug
$436.00

View other "DMTF1 or NM_021145" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 54 kDa
Gene Name cyclin D binding myb like transcription factor 1
Database Link
Background DMTF1 binds specifically to the nonamer DNA consensus sequences CCCG(G/T)ATGT to activate transcription.
Synonyms DMP1; DMTF; hDMP1; MRUL
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Pig: 91%; Guinea pig: 91%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.