ODF2L Rabbit Polyclonal Antibody

SKU TA336157

Rabbit Polyclonal Anti-ODF2L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ODF2L Antibody: synthetic peptide directed towards the N terminal of human ODF2L. Synthetic peptide located within the following region: KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: outer dense fiber of sperm tails 2 like
• Database Link:
  NP_001007023
  Q9ULJ1
• Background: The specific function of this protein remains unknown.
• Synonyms: dJ977L11.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 92%; Yeast: 90%

Reference Data