OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAP1B Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA336122
Rabbit Polyclonal Anti-RAP1B Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402456 Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP321793 Recombinant protein of human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 20 µg
20 ug
$867.00

View other "RAP1B or NM_001010942" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 21 kDa
Gene Name RAP1B, member of RAS oncogene family
Database Link
Background RAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling.RAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling. supplied by OMIM. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-72 BG717530.1 20-91 73-172 BC000176.3 1-100 173-2026 BC000176.3 110-1963 2027-2117 AA809981.1 1-91 c
Synonyms K-REV; RAL1B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Long-term potentiation, MAPK signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products