AADACL4 Rabbit Polyclonal Antibody

SKU TA336097

Rabbit Polyclonal Anti-AADACL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AADACL4 Antibody: synthetic peptide directed towards the N terminal of human AADACL4. Synthetic peptide located within the following region: FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: arylacetamide deacetylase like 4
• Database Link:
  NP_001013652
  Q5VUY2
• Background: The function of this protein remains unknown.
• Synonyms: arylacetamide deacetylase-like 4; OTTHUMP00000001872
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Mouse: 92%; Rabbit: 86%; Horse: 83%

Reference Data

• Protein Families: Transmembrane