TRIM17 Rabbit Polyclonal Antibody

SKU TA336056

Rabbit Polyclonal Anti-TRIM17 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIM17 Antibody: synthetic peptide directed towards the middle region of human TRIM17. Synthetic peptide located within the following region: MKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDATS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: tripartite motif containing 17
• Database Link:
  NP_001020111
  Q9Y577
• Background: TRIM17 encodes a protein that is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed at high levels in the testis, but its function is unknown.
• Synonyms: RBCC; RNF16; terf
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%; Rat: 79%; Yeast: 79%; Bovine: 79%; Pig: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome