DNAJB14 Rabbit Polyclonal Antibody

CAT#: TA336037

Rabbit Polyclonal Anti-DNAJB14 Antibody

Product Images

Host: Rabbit; Target Name: DNAJB14; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; DNAJB14 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DNAJB14 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJB14. Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member B14
• Database Link:
  NP_001026893
  Entrez Gene 79982 Human
  UniProt ID Q8TBM8
• Background: DNAJB14 may act as a co-chaperone.
• Synonyms: EGNR9427; PRO34683
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Horse: 86%; Rat: 83%