MINDY1 Rabbit Polyclonal Antibody

SKU TA335967

Rabbit Polyclonal Anti-FAM63A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM63A Antibody: synthetic peptide directed towards the middle region of human FAM63A. Synthetic peptide located within the following region: LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: family with sequence similarity 63 member A
• Database Link:
  NP_001035307
  Q8N5J2
• Background: The specific function of this protein remains unknown.
• Synonyms: RP11-316M1.5
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 92%; Rabbit: 92%; Dog: 85%; Bovine: 85%

Reference Data