CT47A7 Rabbit Polyclonal Antibody

CAT#: TA335926

Rabbit Polyclonal Anti-CT47A7 Antibody


 Product Datasheet for 'TA335926'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CT47A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human CT47A7. Synthetic peptide located within the following region: PDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKD
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 29 kDa
Gene Name cancer/testis antigen family 47, member A7
Background This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24.
Synonyms CT47.7
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Other products for "CT47A7"
Frequently bought together (2)
Transient overexpression lysate of cancer/testis antigen family 47, member A7 (CT47A7)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones