PRSS56 Rabbit Polyclonal Antibody

SKU TA335881

Rabbit Polyclonal Anti-PRSS56 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRSS56 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS56. Synthetic peptide located within the following region: SRAAGTRFPKRRPEPRGEANGCPGLEPLRQKLAALQGAHAWILQVPSEHL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: protease, serine 56
• Database Link:
  NP_001182058
  P0CW18
• Background: This gene encodes a protein that contains a peptidase S1 domain and possesses trypsin-like serine protease activity. The encoded protein may play a role in eye development, and mutations in this gene are a cause of autosomal recessive posterior microphthalmos.
• Synonyms: MCOP6
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rabbit: 86%

Reference Data