PDHA2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 43 kDa |
| Gene Name | pyruvate dehydrogenase (lipoamide) alpha 2 |
| Database Link | |
| Background | The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). |
| Synonyms | PDHAL |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Rat: 86%; Horse: 85%; Dog: 79%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Pathways | Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, leucine and isoleucine biosynthesis, Metabolic pathways, Pyruvate metabolism, Valine |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.