Il5 Rabbit Polyclonal Antibody

SKU TA335656

Rabbit Polyclonal Anti-Il5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 15 kDa
• Gene Name: interleukin 5
• Database Link:
  NP_034688
  P04401
• Background: The function of Il5 remains unknown.
• Synonyms: EDF; IL-5; interleukin-5; TRF
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data