TMCC1 Rabbit Polyclonal Antibody

SKU TA335603

Rabbit Polyclonal Anti-TMCC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMCC1 Antibody: synthetic peptide directed towards the middle region of human TMCC1. Synthetic peptide located within the following region: YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: transmembrane and coiled-coil domain family 1
• Database Link:
  NP_055823
  O94876
• Background: TMCC1 is a multi-pass membrane proteinPotential. It belongs to the TEX28 family.The exact function of TMCC1 remains unknown.
• Synonyms: DKFZp686M0169; FLJ42680; transmembrane and coiled-coil domain family 1; transmembrane and coiled-coil domains 1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane