PHF21A Rabbit Polyclonal Antibody

CAT#: TA335551

Rabbit Polyclonal Anti-PHF21A Antibody

Product Images

WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PHF21A Antibody: synthetic peptide directed towards the middle region of human PHF21A. Synthetic peptide located within the following region: LSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: PHD finger protein 21A
• Database Link:
  NP_057705
  Entrez Gene 51317 Human
  UniProt ID Q96BD5
• Background: PHF21A (BHC80) is a component of a BRAF35/histone deacetylase complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS).BHC80 is a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]). [supplied by OMIM]
• Synonyms: BHC80; BM-006
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors