RRN3 Rabbit Polyclonal Antibody

SKU TA335517

Rabbit Polyclonal Anti-RRN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RRN3 Antibody: synthetic peptide directed towards the middle region of human RRN3. Synthetic peptide located within the following region: VDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQFFMFYLCSFKLGFAE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: RRN3 homolog, RNA polymerase I transcription factor
• Database Link:
  NP_060897
  Q9NYV6
• Background: In mammals, growth-dependent regulation of RNA polymerase I (Pol I) transcription is mediated by RRN3, an essential initiation factor. It interacts with Pol I in the absence of template DNA, augments Pol I transcription in vivo and rescues transcription in extracts from growth-arrested cells in vitro.
• Synonyms: A-270G1.2; TIFIA
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors