Spaca9 Rabbit Polyclonal Antibody

SKU TA335447

Rabbit Polyclonal Anti-1700026L06Rik Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-1700026L06Rik Antibody is: synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik. Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: sperm acrosome associated 9
• Database Link:
  NP_081559
  Q7TPM5
• Background: The function of this protein remains unknown.
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%

Reference Data