TSSK2 Rabbit Polyclonal Antibody

CAT#: TA335414

Rabbit Polyclonal Anti-TSSK2 Antibody

Product Images

WB Suggested Anti-TSSK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TSSK2 Antibody: synthetic peptide directed towards the middle region of human TSSK2. Synthetic peptide located within the following region: DHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: testis specific serine kinase 2
• Database Link:
  NP_443732
  Entrez Gene 23617 Human
  UniProt ID Q96PF2
• Background: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).
• Synonyms: DGS-G; SPOGA2; STK22B; TSK2
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 86%; Bovine: 79%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase