PGK2 Rabbit Polyclonal Antibody

CAT#: TA335403

Rabbit Polyclonal Anti-PGK2 Antibody

Product Images

WB Suggested Anti-PGK2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PGK2 Antibody: synthetic peptide directed towards the C terminal of human PGK2. Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: phosphoglycerate kinase 2
• Database Link:
  NP_620061
  Entrez Gene 18663 MouseEntrez Gene 5232 Human
  UniProt ID P07205
• Background: PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. See also PGK1 (MIM 311800), which is ubiquitously expressed in all somatic tissues and maps to chromosome Xq13. [supplied by OMIM]. Sequence Note: removed 3 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1675 BC038843.1 4-1678
• Synonyms: dJ417L20.2; HEL-S-272; PGKB; PGKPS
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Zebrafish: 86%; Dog: 85%; Sheep: 85%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways