DNAJC18 Rabbit Polyclonal Antibody

SKU TA335382

Rabbit Polyclonal Anti-DNAJC18 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DNAJC18 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJC18. Synthetic peptide located within the following region: EWTQTRQGEGNSTYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C18
• Database Link:
  NP_689899
  Q9H819
• Background: The function of this protein remains unknown.
• Synonyms: MGC29463
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Goat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data