TRIM50 Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Purified recombinant protein of Homo sapiens tripartite motif-containing 50 (TRIM50), 20 µg
USD 867.00
Other products for "TRIM50"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TRIM50 Antibody: synthetic peptide directed towards the middle region of human TRIM50. Synthetic peptide located within the following region: DWRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | tripartite motif containing 50 |
Database Link | |
Background | TRIM50 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. TRIM50 is an E3 ubiquitin-protein ligase. |
Synonyms | TRIM50A |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.