TRPM2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 171 kDa |
| Gene Name | transient receptor potential cation channel subfamily M member 2 |
| Database Link | |
| Background | TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death.The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | EREG1; KNP3; LTRPC2; NUDT9H; NUDT9L1; TRPC7 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 88%; Guinea pig: 88%; Dog: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
LINC00885 a Novel Oncogenic Long Non-Coding RNA Associated with Early Stage Breast Cancer Progression
Abba, Canzoneri, Gurruchaga et al
Int J Mol Sci (2020) 21 (19) DOI: 10.3390/ijms21197407
Abba, Canzoneri, Gurruchaga et al
Int J Mol Sci (2020) 21 (19) DOI: 10.3390/ijms21197407
Cited by 26
AI Summary: OriGene contributed to this study by providing the rabbit anti-EREG primary antibody used in Western blot analyses to assess protein expression changes related to LINC00885 activity.
Snippet: Protein samples were subjected to 12% SDS/PAGE and Western blot analysis (. The primary antibody used was rabbit anti-EREG (1:1000, Origene, Rockville, MD, USA). Secondary antibodies: HRP-conjugated anti-rabbit secondary antibody (1:2000, Dako, Glostrup, Denmark) and HRP-conjugated anti-mouse secondary antibody (1:1000, Dako, Glostrup, Denmark)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
