AMN1 Rabbit Polyclonal Antibody

SKU TA335002

Rabbit Polyclonal Anti-AMN1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AMN1 antibody: synthetic peptide directed towards the N terminal of human AMN1. Synthetic peptide located within the following region: PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: antagonist of mitotic exit network 1 homolog
• Database Link:
  NP_001106873
  Q8IY45
• Background: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.
• Synonyms: antagonist of mitotic exit network 1 homolog; antagonist of mitotic exit network 1 homolog (S. cerevisiae)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%

Reference Data