ARFIP2 Rabbit Polyclonal Antibody

CAT#: TA334956

Rabbit Polyclonal Anti-ARFIP2 Antibody

Product Images

Host: Rabbit; Target Name: ARFIP2; Sample Tissue: THP-1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARFIP2 antibody is: synthetic peptide directed towards the middle region of Human ARFIP2. Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: ADP ribosylation factor interacting protein 2
• Database Link:
  NP_001229783
  Entrez Gene 23647 Human
  UniProt ID P53365
• Background: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.
• Synonyms: POR1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Sheep: 86%

Reference Data

• Protein Families: Druggable Genome