CCDC75 (GPATCH11) Rabbit Polyclonal Antibody

SKU TA334822

Rabbit Polyclonal Anti-GPATCH11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC75 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC75. Synthetic peptide located within the following region: KSEDLSVLEKLQILTSYLREEHLYCIWCGTAYEDKEDLSSNCPGPTSADH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: G-patch domain containing 11
• Database Link:
  NP_777591
  Q8N954
• Background: The function of this protein remains unknown.
• Synonyms: CCDC75; CENP-Y; CENPY
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%

Reference Data