CCZ1B Rabbit Polyclonal Antibody

SKU TA334820

Rabbit Polyclonal Anti-CCZ1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCZ1B antibody is: synthetic peptide directed towards the N-terminal region of Human CCZ1B. Synthetic peptide located within the following region: PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: CCZ1 homolog B, vacuolar protein trafficking and biogenesis associated
• Database Link:
  NP_932765
  P86790
• Background: The function of this protein remains unknown.
• Synonyms: C7orf28B; H_NH0577018.2
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data