KIFC3 Rabbit Polyclonal Antibody

SKU TA334692

Rabbit Polyclonal Anti-KIFC3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIFC3 antibody: synthetic peptide directed towards the C terminal of human KIFC3. Synthetic peptide located within the following region: EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 93 kDa
• Gene Name: kinesin family member C3
• Database Link:
  NP_005541
  Q9BVG8
• Background: KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.
• Synonyms: DKFZp686D23201; FLJ34694
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome