SLC41A1 Rabbit Polyclonal Antibody

SKU TA334621

Rabbit Polyclonal Anti-SLC41A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC41A1 antibody: synthetic peptide directed towards the N terminal of human SLC41A1. Synthetic peptide located within the following region: TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 41 member 1
• Database Link:
  NP_776253
  Q8IVJ1
• Background: SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance.
• Synonyms: MgtE
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane