SLC35F3 Rabbit Polyclonal Antibody

SKU TA334615

Rabbit Polyclonal Anti-SLC35F3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC35F3 antibody: synthetic peptide directed towards the middle region of human SLC35F3. Synthetic peptide located within the following region: LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 35 member F3
• Database Link:
  NP_775779
  Q8IY50
• Background: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.
• Synonyms: FLJ37712
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane