IFIT5 Rabbit Polyclonal Antibody

CAT#: TA334459

Rabbit Polyclonal Anti-IFIT5 Antibody

Product Images

1Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: IFIT5; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-IFIT5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysateIFIT5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the middle region of human IFIT5. Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: interferon induced protein with tetratricopeptide repeats 5
• Database Link:
  NP_036552
  Entrez Gene 24138 Human
  UniProt ID Q13325
• Background: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.
• Synonyms: ISG58; P58; RI58
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Horse: 79%