IFIT5 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-IFIT5 antibody: synthetic peptide directed towards the N terminal of human IFIT5. Synthetic peptide located within the following region: LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 56 kDa |
| Gene Name | interferon induced protein with tetratricopeptide repeats 5 |
| Database Link | |
| Background | IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown. |
| Synonyms | ISG58; P58; RI58 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 85% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Quantitative Proteomic Analysis of Duck Ovarian Follicles Infected with Duck Tembusu Virus by Label-Free LC-MS
Han, Zhao, Liu et al
Front Microbiol (2016) 7, 463 DOI: 10.3389/fmicb.2016.00463
Han, Zhao, Liu et al
Front Microbiol (2016) 7, 463 DOI: 10.3389/fmicb.2016.00463
Cited by 22
AI Summary: In this study, OriGene's anti-IFIT5 rabbit polyclonal antibody was used for western blot analysis to validate changes in IFIT5 protein expression in duck ovarian follicles following Duck Tembusu virus infection.
Snippet: with 5% (w/v) skimmed milk in TBST (50 mM Tris, pH 8.0, 150 mM NaCl, 0.1% [v/v] Tween-20) for 1 h at 37°C, the membranes were incubated overnight at 4°C with primary rabbit polyclonal antibodies of anti-OASL2 (Abcam, Cambridge, UK), anti-IFIT5 (OriGene, China ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
