SLC10A7 Rabbit Polyclonal Antibody

SKU TA334136

Rabbit Polyclonal Anti-SLC10A7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC10A7 Antibody: synthetic peptide directed towards the middle region of human SLC10A7. Synthetic peptide located within the following region: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: solute carrier family 10 member 7
• Database Link:
  NP_001025169
  Q0GE19
• Background: SLC10A7 belongs to the sodium: bile acid symporter family. It is a multi-pass membrane protein. The function of SLC10A7 remains unknown.
• Synonyms: C4orf13; P7
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane