Lhfpl3 Rabbit Polyclonal Antibody

SKU TA334114

Rabbit Polyclonal Anti-Lhfpl3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Lhfpl3 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lhfpl3. Synthetic peptide located within the following region: TATVYKICAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: lipoma HMGIC fusion partner-like 3
• Database Link:
  NP_001074700
  Q9CTN8
• Background: The function of this protein remains unknown.
• Synonyms: LHFPL4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%; Rat: 79%; Rabbit: 79%

Reference Data