Aamdc Rabbit Polyclonal Antibody

CAT#: TA334093

Rabbit Polyclonal Anti-Aamdc Antibody

Product Images

Host: Rabbit; Target Name: RGD1561459; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Aamdc Antibody is: synthetic peptide directed towards the N-terminal region of Rat Aamdc. Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: adipogenesis associated, Mth938 domain containing
• Database Link:
  NP_001101963
  Entrez Gene 361606 Rat
• Background: The function of this protein remains unknown.
• Synonyms: 1810020D17Rik; 1810037D19Rik; LI2; RGD1561459
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%