SLC6A1 Rabbit Polyclonal Antibody

CAT#: TA334049

Rabbit Polyclonal Anti-SLC6A1 Antibody

Product Images

WB Suggested Anti-SLC6A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC6A1 Antibody: synthetic peptide directed towards the middle region of human SLC6A1. Synthetic peptide located within the following region: LIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: solute carrier family 6 member 1
• Database Link:
  NP_003033
  Entrez Gene 6529 Human
  UniProt ID P30531
• Background: SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
• Synonyms: GABATHG; GABATR; GAT1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane