OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC7A4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA333980
Rabbit Polyclonal Anti-SLC7A4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY401343 Transient overexpression lysate of solute carrier family 7 (cationic amino acid transporter, y+ system), member 4 (SLC7A4) (as WB positive control) 100 ug
$436.00
TP302547 Recombinant protein of human solute carrier family 7 (cationic amino acid transporter, y+ system), member 4 (SLC7A4), 20 µg
20 ug
$867.00

View other "SLC7A4 or NM_004173" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC7A4 Antibody: synthetic peptide directed towards the middle region of human SLC7A4. Synthetic peptide located within the following region: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 68 kDa
Gene Name solute carrier family 7 member 4
Database Link
Background SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Synonyms CAT-4; CAT4; HCAT3; VH
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%; Dog: 85%; Zebrafish: 75%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products