SLC16A8 Rabbit Polyclonal Antibody

SKU TA333876

Rabbit Polyclonal Anti-SLC16A8 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC16A8 Antibody: synthetic peptide directed towards the middle region of human SLC16A8. Synthetic peptide located within the following region: RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: solute carrier family 16 member 8
• Database Link:
  NP_037488
  O95907
• Background: SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
• Synonyms: MCT3; REMP
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Dog: 92%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane