SLC35D1 Rabbit Polyclonal Antibody

SKU TA333845

Rabbit Polyclonal Anti-SLC35D1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35D1 Antibody is: synthetic peptide directed towards the middle region of Human SLC35D1. Synthetic peptide located within the following region: SDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: solute carrier family 35 member D1
• Database Link:
  NP_055954
  Q9NTN3
• Background: The function of this protein remains unknown.
• Synonyms: UGTREL7
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane