OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBC1D1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA333840
Rabbit Polyclonal Anti-TBC1D1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414764 Transient overexpression lysate of TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1 (TBC1D1) (as WB positive control) 100 ug
$436.00
TP307980 Recombinant protein of human TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1 (TBC1D1), 20 µg
20 ug
$737.00

View other "TBC1D1 or NM_015173" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TBC1D1 Antibody: synthetic peptide directed towards the middle region of human TBC1D1. Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 133 kDa
Gene Name TBC1 domain family member 1
Database Link
Background TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (White et al., 2000 PubMed 10965142). supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-225 BC050321.1 13-237 226-950 BC050321.1 896-1620 951-1020 BC028196.1 226-295 1021-1123 BC029950.1 255-357 1124-1433 BC028196.1 399-708 1434-1608 BC029950.1 668-842 1609-4133 BC053648.1 437-2961 4134-5688 AK074954.1 1433-2987
Synonyms TBC; TBC1
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Dog: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products