DDHD2 Rabbit Polyclonal Antibody

SKU TA333835

Rabbit Polyclonal Anti-DDHD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DDHD2 Antibody: synthetic peptide directed towards the N terminal of human DDHD2. Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 81 kDa
• Gene Name: DDHD domain containing 2
• Database Link:
  NP_056029
  O94830
• Background: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
• Synonyms: iPLA(1)gamma; SAMWD1; SPG54
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%

Reference Data