SLC35F2 Rabbit Polyclonal Antibody

CAT#: TA333772

Rabbit Polyclonal Anti-SLC35F2 Antibody

Product Images

WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: 293T

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35F2 Antibody: synthetic peptide directed towards the N terminal of human SLC35F2. Synthetic peptide located within the following region: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: solute carrier family 35 member F2
• Database Link:
  NP_059985
  Entrez Gene 54733 Human
  UniProt ID Q8IXU6
• Background: SLC35F2 is a putative solute transporter.
• Synonyms: HSNOV1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane