SSBP3 Rabbit Polyclonal Antibody

CAT#: TA333762

Rabbit Polyclonal Anti-SSBP3 Antibody

Product Images

WB Suggested Anti-SSBP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SSBP3 Antibody: synthetic peptide directed towards the middle region of human SSBP3. Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: single stranded DNA binding protein 3
• Database Link:
  NP_060540
  Entrez Gene 23648 Human
  UniProt ID Q9BWW4
• Background: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.
• Synonyms: CSDP; SSDP; SSDP1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 91%

Reference Data

• Protein Families: Transcription Factors