HSPA12A Rabbit Polyclonal Antibody

SKU TA333659

Rabbit Polyclonal Anti-HSPA12A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HSPA12A Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA12A. Synthetic peptide located within the following region: KALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQPAKQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: heat shock protein family A (Hsp70) member 12A
• Database Link:
  NP_079291
  O43301
• Background: The function of this protein remains unknown.
• Synonyms: RP11-539I5.1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data