Necap1 Rabbit Polyclonal Antibody

SKU TA333654

Rabbit Polyclonal Anti-Necap1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Necap1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: NECAP endocytosis associated 1
• Database Link:
  NP_080543
  Q9CR95
• Background: Necap1 may be involved in endocytosis.
• Synonyms: DKFZP566B183; MGC131900; NECAP-1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data